PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.182040.1
Common NameCsa_1G569530, LOC101208858
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NF-YB
Protein Properties Length: 91aa    MW: 10507.7 Da    PI: 5.176
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.182040.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC24.27e-085721682
           NF-YC 16 fknhelPlarikkilka.dedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaa 82
                     +  +lP+a + +i+k+  ++  +is ea   +    + fi  +t  +  ++++ +rrtl+  di  a
  Cucsa.182040.1  5 WESLQLPIANVERIMKKiVPEKGKISKEAKKRMQECANEFINFVTSEAAQRCQNENRRTLNGDDIYWA 72
                    56779**********75379******************************************999876 PP

2NF-YB122.91.3e-38989787
           NF-YB  7 flPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87
                     lPianv rimkk++P+++kisk+ak+ +qec+ efi fvtsea+++cq+e+r+t+ngdd++wa+ +lG+++y+e+ ++yl
  Cucsa.182040.1  9 QLPIANVERIMKKIVPEKGKISKEAKKRMQECANEFINFVTSEAAQRCQNENRRTLNGDDIYWAFDSLGLDNYAEASSKYL 89
                    69**************************************************************************99998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-36489IPR009072Histone-fold
SuperFamilySSF471131.71E-29786IPR009072Histone-fold
PfamPF008081.3E-25972IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-103755No hitNo description
PRINTSPR006151.7E-105674No hitNo description
PRINTSPR006151.7E-107591No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MGENWESLQL PIANVERIMK KIVPEKGKIS KEAKKRMQEC ANEFINFVTS EAAQRCQNEN  60
RRTLNGDDIY WAFDSLGLDN YAEASSKYLL X
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B7e-321089887Transcription factor HapC (Eurofung)
4g92_B7e-321089887Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818061e-109LN681806.1 Cucumis melo genomic scaffold, anchoredscaffold00025.
GenBankLN7132561e-109LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004135781.13e-62PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040275e-36NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLA0A0A0LZ173e-62A0A0A0LZ17_CUCSA; Uncharacterized protein
STRINGPGSC0003DMT4000636713e-34(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.13e-37nuclear factor Y, subunit B4
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]